Genome annotation

Author

Jelmer Poelstra

Published

February 8, 2024


Introduction

Setting up

You should have an active VS Code session with an open terminal. In that terminal, you should be be in your dir /fs/scratch/PAS2250/cabana/$USER/bact/bact.


1 The GFF/GTF format

The GTF and GFF formats are very similar tab-delimited tabular files that contain genome annotations, with:

  • One row for each annotated “genomic feature” (gene, exon, etc.)
  • One column for each piece of information about a feature, like its genomic coordinates

See the sample below, with an added header line (not normally present) with column names:

seqname     source  feature start   end     score  strand  frame    attributes
NC_000001   RefSeq  gene    11874   14409   .       +       .       gene_id "DDX11L1"; transcript_id ""; db_xref "GeneID:100287102"; db_xref "HGNC:HGNC:37102"; description "DEAD/H-box helicase 11 like 1 (pseudogene)"; gbkey "Gene"; gene "DDX11L1"; gene_biotype "transcribed_pseudogene"; pseudo "true"; 
NC_000001   RefSeq  exon    11874   12227   .       +       .       gene_id "DDX11L1"; transcript_id "NR_046018.2"; db_xref "GeneID:100287102"; gene "DDX11L1"; product "DEAD/H-box helicase 11 like 1 (pseudogene)"; pseudo "true"; 

Some details on the more important/interesting columns:

  • seqname — Name of the chromosome, scaffold, or contig
  • feature — Name of the feature type, e.g. “gene”, “exon”, “intron”, “CDS”
  • start & end — Start & end position of the feature
  • strand — Whether the feature is on the + (forward) or - (reverse) strand
  • attribute — A semicolon-separated list of tag-value pairs with additional information


2 Annotation with Prokka

We will now annotate our genome assembly with the program Prokka (Seemann 2014, documentation).

Annotation consists of two main steps:

  1. Structural annotation: the identification of genes (and other genomic features)
  2. Functional annotation: the assigment of gene names and functions to genes based on homology with known genes

Prokka will perform both of these steps for us, and its most important output files are a proteome (amino acid) FASTA file, and a GFF annotation file.

Bakta

A more recent bacterial annotation program, Bakta ( Schwenger et al. 2021, documentation) , is generally able to functionally annotate more genes. But it also takes much longer to run, so in the interest of time, we will run Prokka. Otherwise, Prokka and Bakta are similar.


2.1 Running Prokka

If you didn’t do decontamination with Kraken2, please run this!

If you didn’t perform the decontamination step with Kraken2 on the previous page, you’ll have to run the following to make sure your assembly is in the expected spot:

mkdir results/decontam
cp results/spades/SM04/contigs.fasta results/decontam/SM04.fasta

(That is, you’re simply copying your original assembly to a new dir.)

Running Prokka is pretty simple:

source activate /fs/ess/PAS0471/jelmer/conda/prokka

sbatch -A PAS2250 -t 15 -c 12 -o slurm-prokka.out --wrap="
  prokka \
    --outdir results/prokka \
    --prefix SM04 \
    --cpus 12 \
    results/decontam/SM04.fasta
"

2.2 Prokka output

Once its done after a couple of minutes, the end of your slurm-prokka.out file should look as follows:

tail slurm-prokka.out
[14:58:39] results/prokka/SM04.fsa
[14:58:39] results/prokka/SM04.tbl
[14:58:39] results/prokka/SM04.gbk
[14:58:39] results/prokka/SM04.tsv
[14:58:39] Annotation finished successfully.
[14:58:39] Walltime used: 2.42 minutes
[14:58:39] If you use this result please cite the Prokka paper:
[14:58:39] Seemann T (2014) Prokka: rapid prokaryotic genome annotation. Bioinformatics. 30(14):2068-9.
[14:58:39] Type 'prokka --citation' for more details.
[14:58:39] Share and enjoy!

Let’s take a look at the files in the output dir:

ls -lh results/prokka
total 59M
-rw-r--r-- 1 jelmer PAS0471 1.8M Feb  6 14:58 SM04.err
-rw-r--r-- 1 jelmer PAS0471 2.0M Feb  6 14:58 SM04.faa
-rw-r--r-- 1 jelmer PAS0471 5.4M Feb  6 14:58 SM04.ffn
-rw-r--r-- 1 jelmer PAS0471 5.8M Feb  6 14:56 SM04.fna
-rw-r--r-- 1 jelmer PAS0471 5.8M Feb  6 14:58 SM04.fsa
-rw-r--r-- 1 jelmer PAS0471  12M Feb  6 14:58 SM04.gbk
-rw-r--r-- 1 jelmer PAS0471 7.1M Feb  6 14:58 SM04.gff
-rw-r--r-- 1 jelmer PAS0471  62K Feb  6 14:58 SM04.log
-rw-r--r-- 1 jelmer PAS0471  19M Feb  6 14:58 SM04.sqn
-rw-r--r-- 1 jelmer PAS0471 960K Feb  6 14:58 SM04.tbl
-rw-r--r-- 1 jelmer PAS0471 322K Feb  6 14:58 SM04.tsv
-rw-r--r-- 1 jelmer PAS0471   95 Feb  6 14:58 SM04.txt

The .faa files contains the proteome:

less results/prokka/SM04.faa
>LHECFIHF_00002 Pectate lyase L
MRTILLTVLLVVAATAQATDYYVAPNGDDNAAGTKGAPLRTIMRAQQAAKAGDTVYFRGG
VYTYTAGINRCATRTDTVNAITLNNSGSENKPIRYWAYPGETPVFDFSAMKDDCRVKGFN
VTGSWLHLKGLEVKGVPQQPENHLNHESWGIWNSGSHNTFEQLNLHHNMGPGLFIQNGGY
NLVLNTDSHHNYDPYTSNGAGQSADGFGAHIKAGHPGNVFRGCRAWANSDDGFDLINAFS
PVTIESSWAWQQGYLPGTRTKLEAGNGNGIKAGGYGGKYVPDGVKHTVRNSVAFDNKSAG
FYANHHTLALDFINNTAFSNGVNYNMAGIAPDGSLIPLGNLSNNIAYKGRLTVNTEGLDM
AHNSWTLPTPITDADFEDVSDTGWDAPRQPDGSLPVLRSFHLRAGGRLAGMGAFH
>LHECFIHF_00003 hypothetical protein
MSQERYGIRRFALLNTAGYSLGLFPLENPLSVYGANNLGKSASINALQFPILARMSDMSF
GKYSLEQSRRFYFASDTSYILVEVSLPHGPHVIGVVGRGPGGGFGHQFFAYAGELDLGHY
QKNDTCLRQKELFSNLESQGLKAYELKPDELRRLLVGGHTSIPLDLTLIPLRSTSEQSLK
[...output truncated...]

The .gff file is the main annotation file.


2.3 Exploring the GFF file

less -S results/prokka/SM04.gff

Once you scroll past the header…

##gff-version 3
##sequence-region NODE_1_length_1267796_cov_33.239498 1 1267796
##sequence-region NODE_2_length_902255_cov_32.000245 1 902255
##sequence-region NODE_3_length_697265_cov_34.901625 1 697265
##sequence-region NODE_4_length_534491_cov_32.088021 1 534491

…you reach the main annotation table:

NODE_1_length_1267796_cov_33.239498 barrnap:0.9 rRNA    272 381 3.3e-13 +   .   ID=LHECFIHF_00001;locus_tag=LHECFIHF_00001;product=5S ribosomal RNA
NODE_1_length_1267796_cov_33.239498 Prodigal:002006 CDS 518 1765    .   -   0   ID=LHECFIHF_00002;eC_number=4.2.2.2;Name=pelL;gene=pelL;inference=ab initio prediction:Prodigal:002006,similar to AA sequence:UniProtKB:P0C1A7;locus_tag=LHECFIHF_00002;product=Pectate lyase L
NODE_1_length_1267796_cov_33.239498 Prodigal:002006 CDS 1939    4758    .   -   0   ID=LHECFIHF_00003;inference=ab initio prediction:Prodigal:002006;locus_tag=LHECFIHF_00003;product=hypothetical protein
NODE_1_length_1267796_cov_33.239498 Prodigal:002006 CDS 4755    5462    .   -   0   ID=LHECFIHF_00004;inference=ab initio prediction:Prodigal:002006;locus_tag=LHECFIHF_00004;product=hypothetical protein
NODE_1_length_1267796_cov_33.239498 Prodigal:002006 CDS 5452    6729    .   -   0   ID=LHECFIHF_00005;inference=ab initio prediction:Prodigal:002006;locus_tag=LHECFIHF_00005;product=hypothetical protein
NODE_1_length_1267796_cov_33.239498 Prodigal:002006 CDS 6874    7680    .   +   0   ID=LHECFIHF_00006;inference=ab initio prediction:Prodigal:002006;locus_tag=LHECFIHF_00006;product=hypothetical protein
NODE_1_length_1267796_cov_33.239498 Prodigal:002006 CDS 7673    8128    .   +   0   ID=LHECFIHF_00007;eC_number=2.3.1.266;Name=rimI;db_xref=COG:COG0456;gene=rimI;inference=ab initio prediction:Prodigal:002006,similar to AA sequence:UniProtKB:P0A944;locus_tag=LHECFIHF_00007;product=[Ribosomal protein S18]-alanine N-acetyltransferase
NODE_1_length_1267796_cov_33.239498 Prodigal:002006 CDS 8138    8542    .   -   0   ID=LHECFIHF_00008;inference=ab initio prediction:Prodigal:002006;locus_tag=LHECFIHF_00008;product=hypothetical protein
NODE_1_length_1267796_cov_33.239498 Prodigal:002006 CDS 8709    9347    .   +   0   ID=LHECFIHF_00009;eC_number=4.2.1.1;Name=can;db_xref=COG:COG0288;gene=can;inference=ab initio prediction:Prodigal:002006,similar to AA sequence:UniProtKB:P61517;locus_tag=LHECFIHF_00009;product=Carbonic anhydrase 2
NODE_1_length_1267796_cov_33.239498 Prodigal:002006 CDS 9405    11069   .   -   0   ID=LHECFIHF_00010;inference=ab initio prediction:Prodigal:002006;locus_tag=LHECFIHF_00010;product=hypothetical protein

How many genes have been annotated?

awk '$3 == "CDS"' results/prokka/SM04.gff | wc -l
5080

Genes with the name “hypothetical protein” were identified by the structural annotation, but were effectively not functionally annotated: we don’t have any information about their function.

How many “hypothetical proteins” are there?

grep -c "hypothetical protein" results/prokka/SM04.gff
2071


3 Virulence gene identification with Abricate

We will run the program Abricate to identity virulence genes using the Virulence Factor Database (--db vcfdb).

mkdir results/abricate

abricate \
  --db vfdb \
  results/decontam/SM04.fasta \
  > results/abricate/SM04.tab
Using nucl database vfdb:  4366 sequences -  2024-Feb-6
Processing: results/decontam/SM04.fasta
Found 21 genes in results/decontam/SM04.fasta
Tip: have a suggestion for abricate? Tell me at https://github.com/tseemann/abricate/issues
Done.

Let’s take a look at the output:

less -S results/abricate/SM04.tab
Click to show the expected output


#FILE   SEQUENCE    START   END STRAND  GENE    COVERAGE    COVERAGE_MAP    GAPS    %COVERAGE   %IDENTITY   DATABASE    ACCESSION   PRODUCT RESISTANCE
results/decontam/SM04.fasta NODE_12_length_123484_cov_34.382354 35324   36088   +   crc 1-765/780   =============== 0/0 98.08   82.75   vfdb    NP_254019   (crc) catabolite repression control protein [Type IV pili (VF0082) - Adherence (VFC0001)] [Pseudomonas aeruginosa PAO1] 
results/decontam/SM04.fasta NODE_1_length_1267796_cov_33.239498 207972  209374  -   algA    1-1403/1446 ========/====== 2/2 96.96   81.77   vfdb    NP_252241   (algA) phosphomannose isomerase / guanosine 5'-diphospho-D-mannose pyrophosphorylase [Alginate (VF0091) - Biofilm (VFC0271)] [Pseudomonas aeruginosa PAO1]  
results/decontam/SM04.fasta NODE_1_length_1267796_cov_33.239498 211633  212916  -   algI    1-1284/1563 =============.. 0/0 82.15   83.02   vfdb    NP_252238   (algI) alginate o-acetyltransferase AlgI [Alginate (VF0091) - Biofilm (VFC0271)] [Pseudomonas aeruginosa PAO1]  
results/decontam/SM04.fasta NODE_1_length_1267796_cov_33.239498 221445  222830  -   alg8    100-1485/1485   .============== 0/0 93.33   80.23   vfdb    NP_252231   (alg8) alginate-c5-mannuronan-epimerase AlgG [Alginate (VF0091) - Biofilm (VFC0271)] [Pseudomonas aeruginosa PAO1]  
results/decontam/SM04.fasta NODE_1_length_1267796_cov_33.239498 746910  747244  +   pilZ    22-356/357  =============== 0/0 93.84   82.69   vfdb    NP_251650   (pilZ) type 4 fimbrial biogenesis protein PilZ [Type IV pili (VF0082) - Adherence (VFC0001)] [Pseudomonas aeruginosa PAO1]  
results/decontam/SM04.fasta NODE_1_length_1267796_cov_33.239498 1097853 1098324 -   pvdS    43-514/564  .=======/=====. 2/4 83.33   82.91   vfdb    NP_251116   (pvdS) extracytoplasmic-function sigma-70 factor  [Pyoverdine (VF0094) - Nutritional/Metabolic factor (VFC0272)] [Pseudomonas aeruginosa PAO1]  
results/decontam/SM04.fasta NODE_1_length_1267796_cov_33.239498 1112719 1114079 +   pvdH    7-1367/1410 ========/====== 4/4 96.38   80.78   vfdb    NP_251103   (pvdH) diaminobutyrate-2-oxoglutarate aminotransferase PvdH [Pyoverdine (VF0094) - Nutritional/Metabolic factor (VFC0272)] [Pseudomonas aeruginosa PAO1]    
results/decontam/SM04.fasta NODE_1_length_1267796_cov_33.239498 1114207 1114409 +   mbtH-like   1-203/219   ==============. 0/0 92.69   83.25   vfdb    NP_251102   (mbtH-like) MbtH-like protein from the pyoverdine cluster [Pyoverdine (VF0094) - Nutritional/Metabolic factor (VFC0272)] [Pseudomonas aeruginosa PAO1]  
results/decontam/SM04.fasta NODE_3_length_697265_cov_34.901625  20055   20636   -   algU    1-582/582   =============== 0/0 100.00  81.27   vfdb    NP_249453   (algU) alginate biosynthesis protein AlgZ/FimS [Alginate (VF0091) - Biofilm (VFC0271)] [Pseudomonas aeruginosa PAO1]    
results/decontam/SM04.fasta NODE_3_length_697265_cov_34.901625  236211  237704  +   rpoN    1-1494/1494 ========/====== 6/12    99.60   82.20   vfdb    NP_253152   (rpoN) RNA polymerase factor sigma-54 [Type IV pili (VF0082) - Adherence (VFC0001)] [Pseudomonas aeruginosa PAO1]   
results/decontam/SM04.fasta NODE_5_length_350317_cov_33.463137  244380  244745  -   pilH    1-366/366   =============== 0/0 100.00  85.79   vfdb    NP_249100   (pilH) twitching motility protein PilH [Type IV pili (VF0082) - Adherence (VFC0001)] [Pseudomonas aeruginosa PAO1]  
results/decontam/SM04.fasta NODE_5_length_350317_cov_33.463137  244819  245202  -   pilG    1-384/408   =============== 0/0 94.12   82.55   vfdb    NP_249099   (pilG) twitching motility protein PilG [Type IV pili (VF0082) - Adherence (VFC0001)] [Pseudomonas aeruginosa PAO1]  
results/decontam/SM04.fasta NODE_5_length_350317_cov_33.463137  253182  254216  -   pilT    1-1035/1035 ========/====== 2/2 99.90   83.88   vfdb    NP_249086   (pilT) twitching motility protein PilT [Type IV pili (VF0082) - Adherence (VFC0001)] [Pseudomonas aeruginosa PAO1]  
results/decontam/SM04.fasta NODE_5_length_350317_cov_33.463137  346430  347476  -   pilM    19-1065/1065    ========/====== 4/4 98.12   80.17   vfdb    NP_253731   (pilM) type IV pilus inner membrane platform protein PilM [Type IV pili (VF0082) - Adherence (VFC0001)] [Pseudomonas aeruginosa PAO1]   
results/decontam/SM04.fasta NODE_6_length_339735_cov_31.812540  47754   48509   +   flgG    10-762/786  ========/====== 2/3 95.80   80.82   vfdb    NP_249773   (flgG) flagellar basal-body rod protein FlgG [Flagella (VF0273) - Motility (VFC0204)] [Pseudomonas aeruginosa PAO1] 
results/decontam/SM04.fasta NODE_6_length_339735_cov_31.812540  49404   50454   +   flgI    60-1110/1110    =============== 0/0 94.68   82.21   vfdb    NP_249775   (flgI) flagellar P-ring protein precursor FlgI [Flagella (VF0273) - Motility (VFC0204)] [Pseudomonas aeruginosa PAO1]   
results/decontam/SM04.fasta NODE_6_length_339735_cov_31.812540  74115   75108   +   fliG    22-1015/1017    =============== 0/0 97.74   83.80   vfdb    NP_249793   (fliG) flagellar motor switch protein G [Flagella (VF0273) - Motility (VFC0204)] [Pseudomonas aeruginosa PAO1]  
results/decontam/SM04.fasta NODE_6_length_339735_cov_31.812540  82920   83860   +   fliM    1-941/972   ========/====== 2/2 96.71   83.02   vfdb    NP_250134   (fliM) flagellar motor switch protein FliM [Flagella (VF0273) - Motility (VFC0204)] [Pseudomonas aeruginosa PAO1]   
results/decontam/SM04.fasta NODE_6_length_339735_cov_31.812540  84903   85591   +   fliP    70-758/768  .=======/====== 2/2 89.58   81.59   vfdb    NP_250137   (fliP) flagellar biosynthetic protein FliP [Flagella (VF0273) - Motility (VFC0204)] [Pseudomonas aeruginosa PAO1]   
results/decontam/SM04.fasta NODE_6_length_339735_cov_31.812540  91625   92433   +   fleN    10-818/843  =============== 0/0 95.97   82.82   vfdb    NP_250145   (fleN) flagellar synthesis regulator FleN [Flagella (VF0273) - Motility (VFC0204)] [Pseudomonas aeruginosa PAO1]    
results/decontam/SM04.fasta NODE_6_length_339735_cov_31.812540  101666  102120  +   PA1464  26-480/480  =============== 0/0 94.79   84.18   vfdb    NP_250155   (PA1464) purine-binding chemotaxis protein [Flagella (VF0273) - Motility (VFC0204)] [Pseudomonas aeruginosa PAO1]   
Additional Abricate databases

You may also want to run Abricate with other virulence gene databases, such as the BastionHub, and T3SEdb databases. Additionally, you can search for antimicrobial resistance genes with Abricate using e.g. the ResFinder and CARD databases.


4 Bonus: Plasmid detection with MOB-suite

We will run the mob_recon tool from the MOB-suite program (Robertson et al. 2018, documentation) to identity plasmids in our genomes.

mob_recon \
    --infile results/decontam/SM04.fasta \
    --outdir results/mobsuite
2024-02-06 15:35:34,565 mob_suite.mob_recon INFO: MOB-recon version 3.1.4  [in /fs/ess/PAS0471/jelmer/conda/mobsuite/lib/python3.8/site-packages/mob_suite/mob_recon.py:980]
2024-02-06 15:35:34,567 mob_suite.mob_recon INFO: SUCCESS: Found program blastn at /fs/ess/PAS0471/jelmer/conda/mobsuite/bin/blastn [in /fs/ess/PAS0471/jelmer/conda/mobsuite/lib/python3.8/site-packages/mob_suite/utils.py:592]
2024-02-06 15:35:34,569 mob_suite.mob_recon INFO: SUCCESS: Found program makeblastdb at /fs/ess/PAS0471/jelmer/conda/mobsuite/bin/makeblastdb [in /fs/ess/PAS0471/jelmer/conda/mobsuite/lib/python3.8/site-packages/mob_suite/utils.py:592]
2024-02-06 15:35:34,571 mob_suite.mob_recon INFO: SUCCESS: Found program tblastn at /fs/ess/PAS0471/jelmer/conda/mobsuite/bin/tblastn [in /fs/ess/PAS0471/jelmer/conda/mobsuite/lib/python3.8/site-packages/mob_suite/utils.py:592]
# [...output truncated...]

Were any plasmids found?

cat results/mobsuites/mobtyper_results.txt
sample_id   num_contigs size    gc  md5 rep_type(s) rep_type_accession(s)   relaxase_type(s)    relaxase_type_accession(s)  mpf_type    mpf_type_accession(s)   orit_type(s)    orit_accession(s)   predicted_mobility  mash_nearest_neighbor   mash_neighbor_distance  mash_neighbor_identification    primary_cluster_id  secondary_cluster_id    predicted_host_range_overall_rank   predicted_host_range_overall_name   observed_host_range_ncbi_rank   observed_host_range_ncbi_name   reported_host_range_lit_rank    reported_host_range_lit_name    associated_pmid(s)
SM04:AD116  1   48973   0.5424621730341208  fd0b4e82302b32b63f24c1d18a90d219    rep_cluster_283 001576__KY362368_00001  MOBP    CP007015_00034  MPF_T   NC_007275_00041,NZ_CM001987_00038,NC_007275_00033,NC_019328_00069,NC_007275_00028   MOBP    EU289287    conjugative CP006257    0.0572108   Pseudomonas syringae pv. syringae HS191 AD116   -   genus   Pseudomonas genus   Pseudomonas -   -   -


Back to top